Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TUSC3 (Tumor suppressor candidate 3) Full Length (CAT#: MPC1134K) Made to Order

This product is a 39.6 kDa Human TUSC3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TUSC3
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 39.6 kDa
  • TMD
  • 4
  • Sequence
  • MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLA
    EKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCS
    VCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPT
    FMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSG
    TIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVFAMTSGQMWNH
    IRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNE
    AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TUSC3
  • Full Name
  • Tumor suppressor candidate 3
  • Introduction
  • This gene encodes a protein that has been associated with several biological functions including cellular magnesium uptake, protein glycosylation and embryonic development. This protein localizes to the endoplasmic reticulum and acts as a component of the oligosaccharyl transferase complex which is responsible for N-linked protein glycosylation. This gene is a candidate tumor suppressor gene. Homozygous mutations in this gene are associated with autosomal recessive nonsyndromic mental retardation-7 and in the proliferation and invasiveness of several cancers including metastatic pancreatic cancer, ovarian cancer and glioblastoma multiform.
  • Alternative Names
  • TUSC3; M33; N33; MRT7; MRT22; MagT2; OST3A; D8S1992; SLC58A2; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3; magnesium uptake/transporter TUSC3; mental retardation, non-syndromic, autosomal recessive, 22; oligosaccharyl transferase subunit TUSC3; oligosaccharyltransferase 3 homolog A; putative prostate cancer tumor suppressor; Tumor suppressor candidate 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us