Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GJB1 (Gap junction protein beta 1) Full Length (CAT#: MPC0533K) Made to Order

This product is a 32 kDa Human GJB1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GJB1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 32 kDa
  • TMD
  • 4
  • Sequence
  • MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSS
    FICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQH
    IEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFM
    YVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGI
    CIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINK
    LLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • GJB1
  • Full Name
  • Gap junction protein beta 1
  • Introduction
  • This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
  • Alternative Names
  • CMTX; CX32; CMTX1; gap junction beta-1 protein; GAP junction 28 kDa liver protein; connexin-32; gap junction protein, beta 1, 32kDa; GJB1; Gap junction protein beta 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us