Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UQCC3 (Ubiquinol-cytochrome c reductase complex assembly factor 3) Full Length (CAT#: MPC3841K) Made to Order

This product is a made-to-order Human UQCC3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UQCC3
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSR
    EEAARTQQLLLATLQEAATTQENVAWRKNWMVGGEGGAGGRSP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • UQCC3
  • Full Name
  • Ubiquinol-cytochrome c reductase complex assembly factor 3
  • Introduction
  • Complex III is a mitochondrial inner membrane protein complex that transfers electrons from ubiquinol to cytochrome c. This gene encodes a protein that functions in complex III assembly. Mutations in this gene result in Mitochondrial complex III deficiency, nuclear type 9.
  • Alternative Names
  • UQCC3; MC3DN9; UNQ655; C11orf83; CCDS41658.1; UPF0723 protein C11orf83; assembly factor CBP4 homolog; Ubiquinol-cytochrome c reductase complex assembly factor 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us