Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VAMP8 (Vesicle associated membrane protein 8) Full Length (CAT#: MPC0979K) Made to Order

This product is a 11.4 kDa Human VAMP8 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VAMP8
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 11.4 kDa
  • TMD
  • 1
  • Sequence
  • MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTED
    LEATSEHFKTTSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • VAMP8
  • Full Name
  • Vesicle associated membrane protein 8
  • Introduction
  • This gene encodes an integral membrane protein that belongs to the synaptobrevin/vesicle-associated membrane protein subfamily of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs). The encoded protein is involved in the fusion of synaptic vesicles with the presynaptic membrane.
  • Alternative Names
  • EDB; VAMP-8; vesicle-associated membrane protein 8; vesicle-associated membrane protein 8 (endobrevin); VAMP8; Vesicle associated membrane protein 8

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us