Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SDC4 (Syndecan 4) for Antibody Discovery (CAT#: MP0014Q)

This product is a 13.9 kDa Human SDC4 membrane protein expressed in E. col. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SDC4
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 13.9 kDa
  • Sequence
  • MESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Product Description

  • Expression Systems
  • E. coli
  • Purification
  • Conventional chromatography
  • Purity
  • >85% by SDS - PAGE
  • Buffer
  • 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol

Target

  • Target Protein
  • SDC4
  • Full Name
  • Syndecan 4
  • Introduction
  • The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22.
  • Alternative Names
  • SYND4; syndecan-4; amphiglycan; ryudocan amphiglycan; ryudocan core protein; syndecan 4 (amphiglycan, ryudocan); syndecan proteoglycan 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us