Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD37 (CD37 molecule) Expressed in CHO for Antibody Discovery, Partial (110-241aa) (CAT#: MPX0255K)

This product is a 42 kDa Human CD37 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD37
  • Protein Length
  • Partial (110-241aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 42 kDa
  • TMD
  • 4
  • Sequence
  • T
    QITLGILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQL
    RCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQ
    LSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • CD37
  • Full Name
  • CD37 molecule
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • CD37; GP52-40; TSPAN26; leukocyte antigen CD37; cell differentiation antigen 37; leukocyte surface antigen CD37; tetraspanin-26; tspan-26; CD37 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us