Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PET100 (PET100 cytochrome c oxidase chaperone) Full Length (CAT#: MPC1435K) Made to Order

This product is a 9.1 kDa Human PET100 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PET100
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 9.1 kDa
  • TMD
  • 1
  • Sequence
  • MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEI
    EEFKERLRKRREEKLLRDAQQNS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PET100
  • Full Name
  • PET100 cytochrome c oxidase chaperone
  • Introduction
  • Mitochondrial complex IV, or cytochrome c oxidase, is a large transmembrane protein complex that is part of the respiratory electron transport chain of mitochondria. The small protein encoded by this gene plays a role in the biogenesis of mitochondrial complex IV. This protein localizes to the inner mitochondrial membrane and is exposed to the intermembrane space. Mutations in this gene are associated with mitochondrial complex IV deficiency. This gene has a pseudogene on chromosome 3. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • PET100; MC4DN12; C19orf79; protein PET100 homolog, mitochondrial; PET100 homolog; PET100 cytochrome c oxidase chaperone

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us