Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TYROBP (Transmembrane immune signaling adaptor TYROBP) Full Length (CAT#: MPC1873K) Made to Order

This product is a 12.1 kDa Human TYROBP membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TYROBP
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • Molecular Weight
  • 12.1 kDa
  • TMD
  • 1
  • Sequence
  • MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGD
    LVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSD
    VYSDLNTQRPYYK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TYROBP
  • Full Name
  • Transmembrane immune signaling adaptor TYROBP
  • Introduction
  • This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.
  • Alternative Names
  • TYROBP; DAP12; KARAP; PLOSL; PLOSL1; TYRO protein tyrosine kinase-binding protein; DNAX adaptor protein 12; DNAX-activation protein 12; KAR-associated protein; TYRO protein tyrosine kinase binding protein; killer-activating receptor-associated protein; polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy; Transmembrane immune signaling adaptor TYROBP

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us