Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HCST (Hematopoietic cell signal transducer) Full Length (CAT#: MPC1502K) Made to Order

This product is a 9.4 kDa Human HCST membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HCST
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • Molecular Weight
  • 9.4 kDa
  • TMD
  • 1
  • Sequence
  • MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLL
    AGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • HCST
  • Full Name
  • Hematopoietic cell signal transducer
  • Introduction
  • This gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor complex, this protein may activate phosphatidylinositol 3-kinase dependent signaling pathways through its intracytoplasmic YxxM motif. This receptor complex may have a role in cell survival and proliferation by activation of NK and T cell responses. Alternative splicing results in two transcript variants encoding different isoforms.
  • Alternative Names
  • HCST; DAP10; KAP10; PIK3AP; DNAX-activation protein 10; kinase assoc pro of ~10kDa; kinase assoc protein; membrane protein DAP10; phosphoinositide-3-kinase adaptor protein; transmembrane adapter protein KAP10; Hematopoietic cell signal transducer

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us