Creative Biolabs

PHI-27 (Rat)

Datasheet Mdsd
COA

Cat. No.: TDLD-0126-LD1171

PHI-27 (Rat)

PHI-27 (Rat) is a 27-amino acid therapeutic peptide for researching peptide hormones and active peptides. Please note that this product is intended for research purposes only.

Inquiry
SPECIFIC INQUIRY
Quantity:
Clear All Inquiry
For Research Use Only. Not for Diagnostic or Treatment Applications.
Category Therapeutic Peptides
CAS 96849-38-6
Formula C₁₃₆H₂₁₆N₃₆O₄₁
Molecular Weight 3011.44
Sequence (1-letter) HADGVFTSDYSRLLGQISAKKYLESLI-NH2
Sequence (3-letter) His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2
Purity >95%
Form Solid/Powder
Shipping Ice pack
Storage Store at -20°C.
Shelf Life One Year

Click the button below to contact us or submit your feedback about this product.

Customer Reviews and Q&As
Related Products
Neuromedin U (Rat) (TDLD-0126-LD1148) beta-Amyloid (1-11) (Biotinylated) (TDLD-0126-LD943) ERRPRGRRRGRKC (TDLD-0126-LD1043) Ac-RGDS-NH2 (TDLD-0126-LD916) SBP2 (Biotinylated) (TDLD-0126-LD1195) FAM-Labeled (Arg)9 (TDLD-0126-LD1045) CCMV Gag-(7-25) (TDLD-0126-LD978) Cys(NPys)-(Arg)9 (TDLD-0126-LD1018)
Online Inquiry

Customer Review

Creatibe Biolabs' custom LNP was the only solution that successfully delivered our CRISPR-Cas9 payload across the blood-brain barrier with high efficiency and low toxicity.”

Dr. Evelyn Reed

Postdoctoral Researcher, Leading University

Our siRNA candidate was failing due to off-target toxicity, but Creatibe Biolabs' team rapidly redesigned our LNP using their modular platform, rescuing our preclinical program.”

Ben Carter

Project Manager

Achieving cytosolic delivery of our protein degrader with Creatibe Biolabs' exosome platform was the key to unlocking our candidate's full therapeutic potential.”

Dr. Kenji Tanaka

Principal Scientist, Large Pharma Corp

Our oncology drug's efficacy was limited by poor tumor accumulation. Creatibe Biolabs' peptide-conjugated liposomes provided the precise targeting we needed, dramatically increasing the drug's therapeutic index.”

Dr. Clara Schmidt

Senior Scientist, Oncology Innovations Inc.

We required a delivery system that would only release its payload in the tumor's acidic microenvironment. Creatibe Biolabs' pH-responsive liposomes performed flawlessly, minimizing systemic exposure.”

David Chen

Formulation Scientist

Outstanding expertise in antibody engineering.The team's attention to detail and innovative approaches have sianificantly accelerated our development timeline.

Sarah L.

Senior Research Scientist

Contact us for more information Get free consultations