Creative Biolabs

Peptide Products

Challenges in targeted drug delivery often revolve around precisely guiding therapeutic agents to their intended biological targets while minimizing off-target effects. Peptide products have emerged as a highly promising solution, revolutionizing how we approach drug delivery. At Creative Biolabs, we are at the forefront of peptide technology, offering innovative peptide products designed to empower researchers in their pursuit of next-generation therapies for targeted drug delivery.

Overview

Peptides are short chains of amino acids—the essential building blocks of proteins—known for their exceptional versatility and specificity in biological systems. In the field of targeted drug delivery, peptides have become invaluable biomolecules, thanks to their unique ability to bind selectively to specific molecular targets. This precision enables them to effectively guide therapeutic agents to their intended sites of action within the body, significantly reducing off-target effects and enhancing overall therapeutic efficacy.

Flexible & Controllable

The chemical nature of peptides allows for straightforward chemical synthesis with high purity and enables extensive modifications to control stability, pharmacokinetics, and enhance properties like cell penetration and tissue permeability.

Targeted & Biocompatible

Peptides offer high specificity for disease targets, coupled with low immunogenicity and excellent biocompatibility, ensuring precise delivery with minimal adverse reactions.

The advantages of peptides. (Creative Biolabs Original)

Versatile Conjugation

Peptides readily conjugate to diverse payloads and delivery vehicles, enabling intelligent, responsive drug release triggered by physiological cues.

Scalable & Cost-Effective Production

Compared to larger biologics, the chemical synthesis of peptides is often more straightforward, scalable, and cost-effective, facilitating their development and clinical translation.

Explore Our Product Portfolio

View All Products

We offer a wide range of ready-to-use peptide products, from off-the-shelf catalog items to fully customizable solutions tailored to your unique research needs.

Targeting Peptides

Our highly specific targeting peptides enable precise delivery of payloads to desired cells or tissues, minimizing off-target accumulation and enhancing therapeutic index.

Cell-Penetrating Peptides (CPPs)

Facilitate intracellular delivery of various molecules with our efficient CPPs, overcoming cellular membrane barriers for enhanced therapeutic action.

Peptide Linkers

Optimize the connection between peptides and payloads or other molecules, crucial for creating stable and functional conjugates like PDCs.

Responsive Peptides

Utilize peptides designed to respond to specific physiological cues (e.g., pH, enzymes), enabling smart, on-demand drug release at the site of disease.

Fluorescent-labeled Peptides

Ideal for imaging and tracking, these peptides enable real-time visualization of cellular uptake, localization, and target engagement in various assays.

Modified Peptides

Explore our diverse range of modified peptides, including acetylation, biotin-labeled, phosphorylated, and D-amino acid modifications, for enhanced stability and function.

In addition to these types, we support a variety of peptide structures, including linear peptides, branched peptides, asymmetric branched peptides, and cyclic peptides, giving you full control over your therapeutic design.

Need a Custom Solution?

Request a Custom Service Consultation

In addition to our comprehensive range of standard peptide products, Creative Biolabs is dedicated to providing bespoke solutions through our advanced custom services. We understand that groundbreaking research often requires unique approaches, and our goal is to fully meet your specific needs by transforming your innovative ideas into tangible, high-performance delivery solutions.

Peptide Libraries & Screening

Design and generation of diverse peptide libraries for efficient screening to identify novel binding peptides or therapeutic candidates.

Custom Peptide Synthesis Services

Tailored synthesis of peptides with specific sequences, modifications, and purities to meet your exact research requirements.

Peptide-Based Delivery Systems

Expert conjugation of peptides to various molecules, including drugs, imaging agents, or other delivery platforms like liposomes and LNPs.

Peptide Modification Services

Introduction of various chemical modifications to peptides to improve stability, bioavailability, or targeting specificity.

Peptide-Drug Conjugate (PDC) Development

Comprehensive services for the design, synthesis, and characterization of PDCs for targeted therapy.

In Vitro & In Vivo Validation Support

Collaborative design and execution of experiments to assess the efficacy and safety of your peptide-based targeted delivery systems.

Peptide Testing Services

We offer a variety of peptide testing services, including HPLC, MS, LC-MS, sequencing, nuclear magnetic resonance (NMR), MALDI-TOF, and elemental analysis, to ensure the quality and integrity of your peptides.

Case Study

All

Tag Peptide

Case study-His6 Tag Glutathione. (Creative Biolabs Original)

His6 Tag Glutathione

  • M.W.: 1130.16
  • Purity: 95.65%

Applications of Peptide

Applications of our advanced liposome. (Creative Biolabs Authorized)
  • Gene Therapy: CPPs are widely used to deliver genetic materials (siRNA, mRNA, DNA plasmids, RNA-guided gene editing systems) into cells, overcoming membrane barriers for gene editing and expression modulation.
  • Diagnostic Imaging: Fluorescent-labeled peptides or peptides conjugated with various contrast agents are widely used for enhanced disease detection, molecular imaging, and diagnostic purposes, allowing for precise visualization of pathological processes.
  • Regenerative Medicine: Peptides are employed to deliver growth factors, signaling molecules, or genetic material to promote tissue repair, regeneration, and to guide stem cell differentiation and integration.
  • Vaccine Development: Peptides serve as specific antigens to stimulate targeted immune responses or as effective adjuvants to enhance vaccine efficacy.
  • Drug Delivery Vehicle Functionalization: Peptides are frequently conjugated to nanocarriers (e.g., liposomes, nanoparticles) to impart targeting capabilities, improve stability, enhance cellular uptake, and control biodistribution.
  • Protein-Protein Interaction Modulation: Peptides can be designed to selectively disrupt or stabilize specific protein-protein interactions (PPIs), offering a powerful and precise approach for modulating cellular pathways implicated in various diseases.

Why Choose Creative Biolabs?

Product Ordering Process

Process of placing an order. (Creative Biolabs Original)

FAQs

How do peptides achieve targeted delivery?

Peptides are engineered to bind with high affinity to specific receptors or biomarkers on target cells. This highly specific interaction directs the therapeutic payload to the desired site of action.

Can Creative Biolabs help with custom peptide synthesis or specialized peptide-based delivery systems?

Absolutely! Our Related Services are specifically designed to address unique research challenges. If our off-the-shelf peptide products don't perfectly match your requirements, our team of experts can collaborate with you on custom peptide synthesis services tailored to your specific payload, target, and application.

What is the typical lead time for custom peptide synthesis or development projects?

Lead times are contingent upon several factors, including sequence complexity, required modifications, and the overall scope of the project. We work closely with our clients to establish realistic timelines and milestones from the outset. Please contact our team through the inquiry form, and we'll provide a detailed consultation and project proposal.

What peptide purity options are available?

We offer a full range of purities to meet your needs, from crude and desalted to high-purity options of >75%, >80%, >85%, >90%, >95%, and >98%.

What is your production capacity, and how are products packaged?

For linear peptides, we have the capacity to produce from milligrams up to kilograms. We provide custom packaging solutions based on your specific requirements and ensure all peptides are delivered lyophilized for maximum stability.

Filter:

[CAT#: TDLD-0126-LD962]
c(RGDfK)
Category: RGD & RAD Peptides
Sequence (1-letter): cyclo(RGDfK)
Purity: >95%
[CAT#: TDLD-0126-LD890]
5-FAM-Labeled TAT (47-57)
Category: Fluorescent Peptides; Cell-penetrating Peptides
Fluorophore: 5-FAM
Sequence (1-letter): 5FITC-Ahx-YGRKKRRQRRR-OH
Purity: >95%
[CAT#: TDLD-0126-LD1213]
T7
Category: Targeted Peptides
Purity: >95%
[CAT#: TDLD-0126-LD970]
c(RGEfK)
Category: RGD & RAD Peptides
Purity: >95%
Category: Fluorescent Peptides
Fluorophore: 5-FAM
Purity: >95%
[CAT#: TDLD-0126-LD1026]
Cys-TAT (48-60)
Category: Cell-penetrating Peptides
Purity: >95%
[CAT#: TDLD-0126-LD1067]
Flagelin 22
Category: Peptide Tags
Sequence (1-letter): H2N-QRLSTGSRINSAKDDAAGLQIA-OH
Purity: >95%
[CAT#: TDLD-0126-LD1125]
INLKAIAALAKKLL
Category: Cell-penetrating Peptides
Sequence (1-letter): INLKAIAALAKKLL-NH2
Purity: >95%
[CAT#: TDLD-0126-LD939]
B6 Peptide
Category: Cell-penetrating Peptides
Purity: >95%
[CAT#: TDLD-0126-LD1133]
LTVSPWYLTVSPWY
Category: Targeted Peptides
Purity: >95%
[CAT#: TDLD-0126-LD1068]
Flagellin 22
Category: Therapeutic Peptides
Sequence (1-letter): QRLSTGSRINSAKDDAAGLQIA
Purity: >95%
[CAT#: TDLD-0126-LD927]
Angiotensin II (Human)
Category: Therapeutic Peptides
Sequence (1-letter): DRVYIHPF-OH (trifluoroacetate salt)
Purity: >95%
Category: Cell-penetrating Peptides
Sequence (1-letter): H2N-CGGGPKKKRKVED-OH
Purity: >95%
[CAT#: TDLD-0126-LD1004]
CPP9
Category: Cell-penetrating Peptides
Purity: >95%
Category: Biotinylated Peptides
Purity: >95%
[CAT#: TDLD-0126-LD1005]
CRAMP (Mouse)
Category: Therapeutic Peptides
Sequence (1-letter): GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH (trifluoroacetate salt)
Purity: >95%
[CAT#: TDLD-0126-LD916]
Ac-RGDS-NH2
Category: RGD & RAD Peptides
Sequence (1-letter): Ac-RGDS-NH2
Purity: >95%
[CAT#: TDLD-0126-LD1121]
ICG-Labeled cRGD
Category: Fluorescent Peptides; RGD & RAD Peptides
Purity: >95%
[CAT#: TDLD-0126-LD887]
5-FAM-Labeled Substance P
Category: Fluorescent Peptides
Fluorophore: 5-FAM
Purity: >95%
[CAT#: TDLD-0126-LD1198]
Ser-Asp-Gly-Arg
Category: RGD & RAD Peptides
Purity: >95%
[CAT#: TDLD-0126-LD866]
5-FAM-Labeled CRAMP (6-39)
Category: Fluorescent Peptides
Fluorophore: 5-FAM
Purity: >95%
[CAT#: TDLD-0126-LD1076]
G4RGDSP
Category: RGD & RAD Peptides
Purity: >95%
[CAT#: TDLD-0126-LD1242]
VSV-G Tag Peptide
Category: Peptide Tags
Sequence (1-letter): H2N-YTDIEMNRLGK-OH
Purity: >95%
[CAT#: TDLD-0126-LD949]
BMAP-28
Category: Therapeutic Peptides
Sequence (1-letter): GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2
Purity: >95%
[CAT#: TDLD-0126-LD1233]
Urocortin (Human)
Category: Therapeutic Peptides
Sequence (1-letter): DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2
Purity: >95%
[CAT#: TDLD-0126-LD1109]
GRP (Porcine)
Category: Therapeutic Peptides
Sequence (1-letter): APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2
Purity: >95%
[CAT#: TDLD-0126-LD1203]
SP94-SH
Category: Targeted Peptides
Purity: >95%
[CAT#: TDLD-0126-LD1216]
TAT (47-57) GGG-Cys(Npys)
Category: Cell-penetrating Peptides
Purity: >95%
Category: Fluorescent Peptides
Fluorophore: 5-FAM
Purity: >95%
[CAT#: TDLD-0126-LD948]
Biotin-LC-GRGDS
Category: RGD & RAD Peptides; Biotinylated Peptides
Sequence (1-letter): Biotinyl-Ahx-GRGDS-OH
Purity: >95%
[CAT#: TDLD-0126-LD964]
c(RGDfK-COCH2SH)
Category: RGD & RAD Peptides
Purity: >95%
Category: Fluorescent Peptides
Fluorophore: 5-TAMRA
Purity: >95%
[CAT#: TDLD-0126-LD853]
(Arg)8
Category: Cell-penetrating Peptides
Sequence (1-letter): H2N-RRRRRRRR-OH
Purity: >95%
[CAT#: TDLD-0126-LD1161]
Pancreatic PolyPeptide (Rat)
Category: Therapeutic Peptides
Sequence (1-letter): APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2
Purity: >95%
[CAT#: TDLD-0126-LD892]
5-FAM-Labeled TAT(48-57)
Category: Fluorescent Peptides; Cell-penetrating Peptides
Fluorophore: 5-FAM
Purity: >95%
[CAT#: TDLD-0126-LD1219]
TAT (48-60)
Category: Cell-penetrating Peptides
Sequence (1-letter): H2N-GRKKRRQRRRPPQ-OH
Purity: >95%
[CAT#: TDLD-0126-LD1045]
FAM-Labeled (Arg)9
Category: Fluorescent Peptides; Cell-penetrating Peptides
Fluorophore: FAM
Purity: >95%
Category: Biotinylated Peptides
Purity: >95%
[CAT#: TDLD-0126-LD871]
5-FAM-Labeled EB1
Category: Fluorescent Peptides
Fluorophore: 5-FAM
Purity: >95%
[CAT#: TDLD-0126-LD1237]
Urotensin II (Human)
Category: Therapeutic Peptides
Sequence (1-letter): ETPDCFWKYCV
Purity: >95%
[CAT#: TDLD-0126-LD1173]
Plsl
Category: Cell-penetrating Peptides
Purity: >95%
[CAT#: TDLD-0126-LD1246]
WYRGRL
Category: Targeted Peptides
Sequence (1-letter): H2N-WYRGRL-OH
Purity: >95%
[CAT#: TDLD-0126-LD1106]
GRGDTP
Category: RGD & RAD Peptides
Sequence (1-letter): H2N-GRGDTP-OH
Purity: >95%
[CAT#: TDLD-0126-LD1146]
Neurokinin A
Category: Therapeutic Peptides
Sequence (1-letter): HKTDSFVGLM-NH2
Purity: >95%
[CAT#: TDLD-0126-LD920]
Adrenomedullin (1-52) (Human)
Category: Therapeutic Peptides
Sequence (1-letter): YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (trifluoroacetate salt) (Cys16 and 21 bridge)
Purity: >95%
[CAT#: TDLD-0126-LD923]
Allatostatin I
Category: Therapeutic Peptides
Sequence (1-letter): APSGAQRLYGFGL-NH2 (trifluoroacetate salt)
Purity: >95%
[CAT#: TDLD-0126-LD898]
5-FAM-Labeled Woodtide
Category: Fluorescent Peptides
Fluorophore: 5-FAM
Sequence (1-letter): 5FAM-KKISGRLSPIMTEQ-NH2
Purity: >95%
Category: Therapeutic Peptides
Sequence (1-letter): YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
Purity: >95%
Category: Fluorescent Peptides
Fluorophore: FAM
Purity: >95%
[CAT#: TDLD-0126-LD1188]
Rhodopsin Epitope Tag Peptide
Category: Peptide Tags
Sequence (1-letter): H2N-TETSQVAPA-OH
Purity: >95%
Online Inquiry

Customer Review

Creatibe Biolabs' custom LNP was the only solution that successfully delivered our CRISPR-Cas9 payload across the blood-brain barrier with high efficiency and low toxicity.”

Dr. Evelyn Reed

Postdoctoral Researcher, Leading University

Our siRNA candidate was failing due to off-target toxicity, but Creatibe Biolabs' team rapidly redesigned our LNP using their modular platform, rescuing our preclinical program.”

Ben Carter

Project Manager

Achieving cytosolic delivery of our protein degrader with Creatibe Biolabs' exosome platform was the key to unlocking our candidate's full therapeutic potential.”

Dr. Kenji Tanaka

Principal Scientist, Large Pharma Corp

Our oncology drug's efficacy was limited by poor tumor accumulation. Creatibe Biolabs' peptide-conjugated liposomes provided the precise targeting we needed, dramatically increasing the drug's therapeutic index.”

Dr. Clara Schmidt

Senior Scientist, Oncology Innovations Inc.

We required a delivery system that would only release its payload in the tumor's acidic microenvironment. Creatibe Biolabs' pH-responsive liposomes performed flawlessly, minimizing systemic exposure.”

David Chen

Formulation Scientist

Outstanding expertise in antibody engineering.The team's attention to detail and innovative approaches have sianificantly accelerated our development timeline.

Sarah L.

Senior Research Scientist

Contact us for more information Get free consultations