Complement C4B Blocking Peptide-1(Cat#: CTD-047)
This product is a synthetic peptide that used for blocking the activity of human Complement C4B antibody.
Summary
Related Products & Services
Specifications
Sequence |
QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM |
Purity |
>90% |
Pack Size |
100 µg |
Format |
Lyophilized |
Conjugate |
Unconjugated |
Species Reactivity |
Human |
Applications |
IHC; WB |
Storage |
Short at 4°C for short term and at -20°C for long term. |
Information
Introduction |
Complement C4B is a non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens. Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.