Complement C2 Blocking Peptide-6(Cat#: CTD-033)
This product is a synthetic peptide that used for blocking the activity of human, mouse and rat Complement C2 antibody.
Summary
Related Products & Services
Specifications
| Sequence |
EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS |
| Solubility |
Soluble in Water. |
| Purity |
>90% |
| Pack Size |
100 μg |
| Format |
Lyophilized |
| Conjugate |
Unconjugated |
| Species Reactivity |
Human; Mouse;Rat |
| Applications |
IHC; WB |
| Storage |
Short at 4°C for short term and at -20°C for long term. |
Information
| Introduction |
Complement C2 is a part of the classical pathway of the complement system, which is cleaved by activated factor C1 into two fragments: C2b and C2a. C2a, a serine protease, then combines with complement factor C4b to generate the C3 or C5 convertase. C2 is a major histocompatibility complex class-III protein. Selective cleavage of Arg-|-Ser bond in complement component C3 alpha-chain to form C3a and C3b, and Arg-|-Xaa bond in complement component C5 alpha-chain to form C5a and C5b. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
