Close

Anti-ABCC1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-3646-FY)


All products and services are For Research Use Only and CANNOT be used in the treatment or diagnosis of disease.

This product is the plasmid containing an encoded anti-ABCC1 DMAb sequence. The plasmid can drive transcription and in vivo translation of the desired antibody.

  Add to Cart

Specifications

  • Target
  • ABCC1
  • Vector Name
  • pVAX1
  • Vector Description
  • pVAX1 was originally designed for the development of DNA vaccines. Its eukaryotic DNA sequences limited to the expression of desired sequence so that minimize the possibility of chromosomal integration. This vector has been widely used for the construction of DMAb plasmid.
  • Vector Promoter
  • CMV
  • Vector Tag or Fusion
  • Untagged
  • Delivery Method
  • Transfection
  • Cloning Method
  • Restriction Enzyme ⁄ MCS
  • Constitutive or Inducible System
  • Constitutive
  • Storage
  • Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term.
  • Background
  • DNA-encoded mAb (DMAb) technology is a novel approach for a direct in vivo production of desired biologically active immunoglobulins according to the plasmid DNA delivery into tissue where the delivered plasmid containing an encoded antibody sequence. Compared with the traditional mAb, DMAb can be functionally equivalent with additional advantages such as expression profiles, glycosylation, as well as no reliance on in vivo tissue culture and costly or time-consuming production systems. The DMAb technology may provide a novel, simple, less frequent, cost-effective approach for therapeutics.

Target

  • Entrez Gene ID
  • 4363
Sub CAT. DMAb Clone DMAb Host Target Species DMAb Isotype DMAb Immunogen  
DMAb-3646-FY CBFYM-0154 Mouse Human IgG2a
DMAb-3647-FY CBFYM-0332 Mouse Human IgG1 Recombinant peptide (a.a. 1-33) of human MRP1
DMAb-3648-FY CBFYM-0392 Mouse Human IgG1 H69AR human small cell lung cancer cell line membrane extracts
DMAb-3649-FY CBFYM-0803 Mouse Human IgG2a Bacterial fusion protein of MRP1, containing aa986-1204 of the protein
DMAb-3650-FY CBFYM-0804 Mouse Human IgG1, k Partial recombinant protein corresponding to a portion of amino acids within aa1-110 of human ABCC4 with a GST tag. The MW of the GST tag alone is 26kD. (AAH41560)
DMAb-3651-FY CBFYM-0805 Mouse Human IgG2 Recombinant human MRP1 (multidrug resistance-associated protein 1) (aa 986-1204)
DMAb-3652-FY CBFYM-0806 Mouse Human IgG1 Recombinant human MRP1 (multidrug resistance-associated protein 1) (aa 1294-1531)
DMAb-3653-FY CBFYM-0807 Mouse Human IgG1 Membranes prepared from the human small cell lung cancer cell line H69AR
DMAb-3654-FY CBFYM-0808 Mouse Human IgG1 Recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein.
DMAb-3655-FY CBFYM-0809 Mouse Human IgG1 Recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1.
DMAb-3656-FY CBFYM-0810 Rat Human IgG2a Recombinant human MRP1 (multidrug resistance-associated protein 1) (aa 192-360)
DMAb-3657-FY CBFYM-0811 Rat Human IgG2a Fusion protein containing the E. coli maltose binding protein and a fragment of the human MRP4 protein corresponding to aa372-431
DMAb-3658-FY CBFYM-0812 Rat Human IgG2a Bacterial fusion protein containing 168 aa (aa 192-360) in the amino proximal half of MRP1

Customer Reviews and Q&As

There are currently no customer reviews or questions for Anti-ABCC1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-3646-FY). Click the button below to contact us or submit your feedback about this product.

For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.

Related Products

Online Inquiry

For any technical issues or product/service related questions, please leave your information below. Our team will contact you soon.

This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

Key Updates
Newsletter NEWSLETTER

The latest newsletter to introduce the latest breaking information, our site updates, field and other scientific news, important events, and insights from industry leaders

LEARN MORE NEWSLETTER
New Solution NEW SOLUTION

CellRapeutics™ In Vivo Cell Engineering: One-stop in vivo T/B/NK cell and macrophage engineering services covering vectors construction to function verification.

LEARN MORE SOLUTION
NOVEL SOLUTION NOVEL TECHNOLOGY

Silence™ CAR-T Cell: A novel platform to enhance CAR-T cell immunotherapy by combining RNAi technology to suppress genes that may impede CAR functionality.

LEARN MORE NOVEL TECHNOLOGY
NEW TECHNOLOGY NEW SOLUTION

Canine CAR-T Therapy Development: From early target discovery, CAR design and construction, cell culture, and transfection, to in vitro and in vivo function validation.

LEARN MORE SOLUTION
Receive our latest news and insights.