All products and services are For Research Use Only and CANNOT be used in the treatment or diagnosis of disease.
This product is the plasmid containing an encoded anti-ABCC1 DMAb sequence. The plasmid can drive transcription and in vivo translation of the desired antibody.
Sub CAT. | DMAb Clone | DMAb Host | Target Species | DMAb Isotype | DMAb Immunogen | |
DMAb-3646-FY | CBFYM-0154 | Mouse | Human | IgG2a | ||
DMAb-3647-FY | CBFYM-0332 | Mouse | Human | IgG1 | Recombinant peptide (a.a. 1-33) of human MRP1 | |
DMAb-3648-FY | CBFYM-0392 | Mouse | Human | IgG1 | H69AR human small cell lung cancer cell line membrane extracts | |
DMAb-3649-FY | CBFYM-0803 | Mouse | Human | IgG2a | Bacterial fusion protein of MRP1, containing aa986-1204 of the protein | |
DMAb-3650-FY | CBFYM-0804 | Mouse | Human | IgG1, k | Partial recombinant protein corresponding to a portion of amino acids within aa1-110 of human ABCC4 with a GST tag. The MW of the GST tag alone is 26kD. (AAH41560) | |
DMAb-3651-FY | CBFYM-0805 | Mouse | Human | IgG2 | Recombinant human MRP1 (multidrug resistance-associated protein 1) (aa 986-1204) | |
DMAb-3652-FY | CBFYM-0806 | Mouse | Human | IgG1 | Recombinant human MRP1 (multidrug resistance-associated protein 1) (aa 1294-1531) | |
DMAb-3653-FY | CBFYM-0807 | Mouse | Human | IgG1 | Membranes prepared from the human small cell lung cancer cell line H69AR | |
DMAb-3654-FY | CBFYM-0808 | Mouse | Human | IgG1 | Recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. | |
DMAb-3655-FY | CBFYM-0809 | Mouse | Human | IgG1 | Recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. | |
DMAb-3656-FY | CBFYM-0810 | Rat | Human | IgG2a | Recombinant human MRP1 (multidrug resistance-associated protein 1) (aa 192-360) | |
DMAb-3657-FY | CBFYM-0811 | Rat | Human | IgG2a | Fusion protein containing the E. coli maltose binding protein and a fragment of the human MRP4 protein corresponding to aa372-431 | |
DMAb-3658-FY | CBFYM-0812 | Rat | Human | IgG2a | Bacterial fusion protein containing 168 aa (aa 192-360) in the amino proximal half of MRP1 |
There are currently no customer reviews or questions for Anti-ABCC1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-3646-FY). Click the button below to contact us or submit your feedback about this product.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
For any technical issues or product/service related questions, please leave your information below. Our team will contact you soon.
The latest newsletter to introduce the latest breaking information, our site updates, field and other scientific news, important events, and insights from industry leaders
LEARN MORE NEWSLETTERCellRapeutics™ In Vivo Cell Engineering: One-stop in vivo T/B/NK cell and macrophage engineering services covering vectors construction to function verification.
LEARN MORE SOLUTIONSilence™ CAR-T Cell: A novel platform to enhance CAR-T cell immunotherapy by combining RNAi technology to suppress genes that may impede CAR functionality.
LEARN MORE NOVEL TECHNOLOGYCanine CAR-T Therapy Development: From early target discovery, CAR design and construction, cell culture, and transfection, to in vitro and in vivo function validation.
LEARN MORE SOLUTION