All products and services are For Research Use Only and CANNOT be used in the treatment or diagnosis of disease.
This product is the plasmid containing an encoded anti-DICER1 DMAb sequence. The plasmid can drive transcription and in vivo translation of the desired antibody.
Sub CAT. | DMAb Clone | DMAb Host | Target Species | DMAb Isotype | DMAb Immunogen | |
DMAb-495-YC | 13D6 | Mouse | IgG2a | |||
DMAb-496-YC | 1D9 | Mouse | Human | IgG1 | Human recombinant protein fragment corresponding to amino acids 1666-1922 of human DICER1 (NP_085124) produced in E.coli | |
DMAb-497-YC | 1G8 | Mouse | Human | IgG2b | Human recombinant protein fragment corresponding to amino acids 1666-1922 of human DICER1 (NP_085124) produced in E.coli | |
DMAb-498-YC | 2B1 | Mouse | Human | IgG2a | Human recombinant protein fragment corresponding to amino acids 1666-1922 of human DICER1 (NP_085124) produced in E.coli | |
DMAb-499-YC | 336CT7.4.2 | Mouse | Human | IgG1 | DICER1 Mab is generated from mouse immunized with DICER1 recombinant protein | |
DMAb-500-YC | 4A6 | Mouse | Human | IgG1 | ||
DMAb-501-YC | ACM4 | Mouse | Human | IgG | ||
DMAb-502-YC | CL0378 | Mouse | Human | IgG2a | A recombinant protein corresponding to amino acids: PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH | |
DMAb-503-YC | S167-7 | Mouse | IgG1 | |||
DMAb-504-YC | 11C1026 | Rabbit | Human | IgG | Synthetic peptide corresponding to residues surrounding Ala1123 of human | |
DMAb-505-YC | 11C1027 | Rabbit | Human | IgG | Synthetic peptide corresponding to the sequence near the amino terminus of human Dicer | |
DMAb-506-YC | D38E7 | Rabbit | Human | IgG | ||
DMAb-507-YC | D5F2 | Rabbit | Human | IgG | ||
DMAb-508-YC | 2F12 | Mouse | Human | IgG1, κ | DICER1 (NP_803187, 1813 a.a. ~ 1912 a.a) partial recombinant protein with GST tag. The immunogen sequence: ESLAGAIYMD SGMSLETVWQ VYYPMMRPLI EKFSANVPRS PVRELLEMEP ETAKFSPAER TYDGKVRVTV EVVGKGKFKG VGRSYRIAKS AAARRALRSL | |
DMAb-509-YC | N167-7 | Mouse | Mammalian | IgG1 |
There are currently no customer reviews or questions for Anti-DICER1 DNA-encoded mAb (DMAb), pVAX1 (DMAb-495-YC). Click the button below to contact us or submit your feedback about this product.
For research use only. Not intended for any clinical use. No products from Creative Biolabs may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative Biolabs.
For any technical issues or product/service related questions, please leave your information below. Our team will contact you soon.
The latest newsletter to introduce the latest breaking information, our site updates, field and other scientific news, important events, and insights from industry leaders
LEARN MORE NEWSLETTERCellRapeutics™ In Vivo Cell Engineering: One-stop in vivo T/B/NK cell and macrophage engineering services covering vectors construction to function verification.
LEARN MORE SOLUTIONSilence™ CAR-T Cell: A novel platform to enhance CAR-T cell immunotherapy by combining RNAi technology to suppress genes that may impede CAR functionality.
LEARN MORE NOVEL TECHNOLOGYCanine CAR-T Therapy Development: From early target discovery, CAR design and construction, cell culture, and transfection, to in vitro and in vivo function validation.
LEARN MORE SOLUTION