Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ADGRG5 (Adhesion G protein-coupled receptor G5) Expressed in CHO for Antibody Discovery, Partial (22-184aa) (CAT#: MPX0022K)

This product is a 19.4 kDa Human ADGRG5 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADGRG5
  • Protein Length
  • Partial (22-184aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 19.4 kDa
  • TMD
  • 7
  • Sequence
  • ETWEELLSYMENMQVSRGRSSVFSSRQLH
    QLEQMLLNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQA
    GGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFKDENNSSL
    LNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEG

Product Description

  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • ADGRG5
  • Full Name
  • Adhesion G protein-coupled receptor G5
  • Introduction
  • This gene encodes a member of the adhesion family of G-protein coupled receptors. Members of this family are characterized by long N-termini and multiple functional domains. They may play a role in the immune system as well as in the central nervous system. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • PGR27; GPR114; G protein-coupled receptor 114; G protein-coupled receptor PGR27; probable G-protein coupled receptor 114; ADGRG5; Adhesion G protein-coupled receptor G5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us