Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Dictyostelium discoideum (Slime mold) wacA (Aquaporin-like protein) for Antibody Discovery (CAT#: MP1474J)

This product is a 29.9 kDa Dictyostelium discoideum (Slime mold) wacA membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Dictyostelium discoideum (Slime mold)
  • Target Protein
  • wacA
  • Protein Length
  • Full-length
  • Protein Class
  • Aquaporin
  • Molecular Weight
  • 29.9 kDa
  • TMD
  • 6
  • Sequence
  • MPFLHLFTPYTNADNTKLILRVNESRLRLFTRQLLAEFFGTLFVVYIVSGSTLAANFAVSDPIVRVCLICLVQGFAFAAIIWSISGISGCQLNPAVTVGCVTTGRMGILNGIAFIIFQCVGALVGAGMMKASLPTFYERDLSATTLATGVNVARGFFLEMVTTSFLVFVVLGVAVYNEWDPKISRVAPLAIGCAVIAGVGFLNLFTGGSLNPARSFGPAVFSDTWHRHYIYWFGPICGGIIAGLFWRIFLSEKVLLIDRPYTDFHRSTYGTATK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • wacA
  • Full Name
  • Aquaporin-like protein
  • Introduction
  • May form a water-specific channel.
  • Alternative Names
  • wacA; DDB_G0280537Aquaporin C; Aquaporin-like protein wacA; Water channel protein A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us