Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein E.coli lacY (Lactose permease) Expressed in vitro E.coli expression system for Antibody Discovery, Partial (1-250aa) (CAT#: MPX0841K)

This product is a 34.4 kDa E.coli lacY membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • E.coli
  • Target Protein
  • lacY
  • Protein Length
  • Partial (1-250aa)
  • Protein Class
  • Transport
  • Molecular Weight
  • 34.4 kDa
  • TMD
  • 12
  • Sequence
  • MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFTINNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSCTYDVFDQQFANFFTSF

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • lacY
  • Full Name
  • Lactose permease
  • Introduction
  • Major Facilitator Superfamily (MFS). [More information is available at EcoGene: EG10526]. The lactose permease LacY is a lactose/proton symporter, responsible for the uptake of lactose and other galactosides.
  • Alternative Names
  • lacY; ECK0340; Lactose permease

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us