Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ADGRE4P (Adhesion G protein-coupled receptor E4, pseudogene) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3577K)

This product is a Human ADGRE4P membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADGRE4P
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • GPCR
  • TMD
  • 7
  • Sequence
  • CPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWVSGVKPGFGKQLPGDKRTKHICVYWEGSEGGWSTEGCSHVHSNGSYTKCKCFHLSSFAVLVALAPKEDPVLTVITQVGLTISLLCLFLAILTFLLCRPIQNTSTSLHLELSLCLFLAHLLFLTGINRTEPEVLCSIIAGLLHFLYLACFTWMLLEGLHLFLTVRNLKVANYTSTGRFKKRFMYPVGYGIPAVIIAVSAIVGPQNYGTFTCWLKLDKGFIWSFMGPVAVIILINLVFYFQVLWILRSKLSSLNKEVSTIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTIGSIIAYSFTIINTLQGVLLFVVHCLLNRQVRLIILSVISLVPKSN

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ADGRE4P
  • Full Name
  • Adhesion G protein-coupled receptor E4, pseudogene
  • Introduction
  • This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene.
  • Alternative Names
  • ADGRE4P; EMR4; FIRE; EMR4P; PGR16; GPR127; EGF-TM7 receptor EMR4; G protein-coupled receptor 127; egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene; Adhesion G protein-coupled receptor E4, pseudogene

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us