Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ADORA1 (Adenosine A1 receptor) Full Length (CAT#: MPC0021K) Made to Order

This product is a 36.5 kDa Human ADORA1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADORA1
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 36.5 kDa
  • TMD
  • 7
  • Sequence
  • MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVS
    LAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLA
    IAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLS
    AVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIY
    LEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPL
    HILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL

    KIWNDHFRCQPAPPIDEDLPEERPDD

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Flag tag at N-terminal and 8-His tag at C-terminal
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • ADORA1
  • Full Name
  • Adenosine A1 receptor
  • Introduction
  • The protein encoded by this gene is an adenosine receptor that belongs to the G-protein coupled receptor 1 family. There are 3 types of adenosine receptors, each with a specific pattern of ligand binding and tissue distribution, and together they regulate a diverse set of physiologic functions. The type A1 receptors inhibit adenylyl cyclase, and play a role in the fertilization process. Animal studies also suggest a role for A1 receptors in kidney function and ethanol intoxication. Transcript variants with alternative splicing in the 5' UTR have been found for this gene.
  • Alternative Names
  • RDC7; adenosine A1 receptor variant 1; adenosine A1 receptor variant 2; AA1R; ADORA1; Adenosine A1 receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us