Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ADRB1 (Adrenoceptor beta 1) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (378-477aa) (CAT#: MPX4399K)

This product is a 12.5kDa Human ADRB1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADRB1
  • Protein Length
  • Partial (378-477aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 12.5kDa
  • TMD
  • 7
  • Sequence
  • CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ADRB1
  • Full Name
  • Adrenoceptor beta 1
  • Introduction
  • The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Beta-1 adrenoceptors are predominately located in the heart. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure.
  • Alternative Names
  • adrenergic, beta-1-, receptor; beta-1 adrenoceptor; beta-1 adrenoreceptorRHR; B1AR; FNSS2; ADRB1R; BETA1AR; ADRB1; Adrenoceptor beta 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us