Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ARL6IP1 (ADP ribosylation factor like GTPase 6 interacting protein 1) Full Length (CAT#: MPC2346K) Made to Order

This product is a made-to-order Human ARL6IP1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ARL6IP1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 3
  • Sequence
  • MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMG
    VVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTE
    QQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAW
    VGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEK
    KNE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • ARL6IP1
  • Full Name
  • ADP ribosylation factor like GTPase 6 interacting protein 1
  • Introduction
  • This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • ARL6IP1; AIP1; ARMER; SPG61; ARL6IP; ADP-ribosylation factor-like protein 6-interacting protein 1; ADP-ribosylation factor GTPase 6 interacting protein 1; ADP-ribosylation factor-like 6 interacting protein 1; ARL-6-interacting protein 1; aip-1; apoptotic regulator in the membrane of the endoplasmic reticulum; ADP ribosylation factor like GTPase 6 interacting protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us