Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ASAH2 (N-acylsphingosine amidohydrolase 2) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (610-780aa) (CAT#: MPX4150K)

This product is a 25.2 kDa Human ASAH2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ASAH2
  • Protein Length
  • Partial (610-780aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 25.2 kDa
  • TMD
  • 1
  • Sequence
  • FRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ASAH2
  • Full Name
  • N-acylsphingosine amidohydrolase 2
  • Introduction
  • Ceramidases (EC 3.5.1.23), such as ASAH2, catalyze hydrolysis of the N-acyl linkage of ceramide, a second messenger in a variety of cellular events, to produce sphingosine. Sphingosine exerts both mitogenic and apoptosis-inducing activities, and its phosphorylated form functions as an intra- and intercellular second messenger (see MIM 603730).
  • Alternative Names
  • ASAH2; HNAC1; BCDase; LCDase; NCDase; N-CDase; neutral ceramidase; N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2; acylsphingosine deacylase 2; mitochondrial ceramidase; neutral/alkaline ceramidase; non-lysosomal ceramidase; N-acylsphingosine amidohydrolase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us