Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ATP6V0B (ATPase H+ transporting V0 subunit b) Full Length (CAT#: MPC1927K) Made to Order

This product is a 21.4 kDa Human ATP6V0B membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP6V0B
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 21.4 kDa
  • TMD
  • 5
  • Sequence
  • MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWS
    NLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAV
    AIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLF
    CGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSR
    VKMGD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • ATP6V0B
  • Full Name
  • ATPase H+ transporting V0 subunit b
  • Introduction
  • This gene encodes a portion of the V0 domain of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Activity of this enzyme is necessary for such varied processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • ATP6V0B; ATP6F; HATPL; VMA16; V-type proton ATPase 21 kDa proteolipid subunit; ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b; ATPase, H+ transporting, lysosomal, 21-KD, V0 subunit C-prime, prime; ATPase, H+ transporting, lysosomal, subunit F; H(+)-transporting two-sector ATPase, subunit F; V-ATPase 21 kDa proteolipid subunit; V-ATPase subunit b; V-ATPase subunit c''; vacuolar ATP synthase 21 kDa proteolipid subunit; vacuolar proton pump 21 kDa proteolipid subunit; ATPase H+ transporting V0 subunit b

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us