Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ATP9B (ATPase phospholipid transporting 9B (putative)) for Antibody Discovery (CAT#: MP0111X)

This product is a 42.7 kDa Human ATP9B membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP9B
  • Protein Length
  • Full-length
  • Molecular Weight
  • 42.7 kDa
  • TMD
  • 10
  • Sequence
  • MPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLMT

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • ATP9B
  • Full Name
  • ATPase phospholipid transporting 9B (putative)
  • Introduction
  • ATP9B (ATPase Phospholipid Transporting 9B (Putative)) is a Protein Coding gene. Diseases associated with ATP9B include Cholestasis, Benign Recurrent Intrahepatic, 1 and Robinow Syndrome, Autosomal Dominant 2. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Ion channel transport. Gene Ontology (GO) annotations related to this gene include nucleotide binding and cation-transporting ATPase activity. An important paralog of this gene is ATP9A
  • Alternative Names
  • ATPASEP; ATPIIB; DKFZp686H2093; FLJ46612; HUSSY-20; MGC150650; MGC150651; MGC61572; NEO1L; ATPase type IV, phospholipid transporting (P-type)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us