Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human B3GALNT1 (Beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)) Full Length (CAT#: MPC3790K) Made to Order

This product is a made-to-order Human B3GALNT1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • B3GALNT1
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWM
    YFYEYEPIYRQDFHFTLREHSNCSHQNPFLVILVTSHPSDVKARQAIRVT
    WGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLYGDIIRQDFLD
    TYNNLTLKTIMAFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYLLNLNHS
    EKFFTGYPLIDNYSYRGFYQKTHISYQEYPFKVFPPYCSGLGYIMSRDLV
    PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
    QLRRVIAAHGFSSKEIITFWQVMLRNTTCHY

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • B3GALNT1
  • Full Name
  • Beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
  • Introduction
  • This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). The encoded protein of this gene does not use N-acetylglucosamine as an acceptor sugar at all.
  • Alternative Names
  • B3GALNT1; P; P1; GLOB; GLCT3; galT3; Gb4Cer; B3GALT3; beta3Gal-T3; UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1; P antigen synthase; P blood group globoside; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 3 (Globoside blood group); UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 1 (Globoside blood group); UDP-N-acetylgalactosamine:globotriaosylceramide beta-1,3-N-acetylgalactosaminyltransferase; b3Gal-T3; beta-1,3-GalNAc-T1; beta-1,3-GalTase 3; beta-1,3-galactosyltransferase 3; beta-3-Gx-T3; brainiac1; galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase; globoside synthase; globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase; Beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us