Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BAX (BCL2 associated X, apoptosis regulator) Full Length (CAT#: MPC2042K) Made to Order

This product is a 21.1 kDa Human BAX membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BAX
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 21.1 kDa
  • TMD
  • 1
  • Sequence
  • MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
    PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
    SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
    WIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • BAX
  • Full Name
  • BCL2 associated X, apoptosis regulator
  • Introduction
  • The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
  • Alternative Names
  • BAX; BCL2L4; apoptosis regulator BAX; BCL2 associated X protein; BCL2-associated X protein omega; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; bcl-2-like protein 4; bcl2-L-4; BCL2 associated X, apoptosis regulator

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us