Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BCL2L1 (BCL2 like 1) Full Length (CAT#: MPC1096K) Made to Order

This product is a 26 kDa Human BCL2L1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BCL2L1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 26 kDa
  • TMD
  • 1
  • Sequence
  • MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
    INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
    YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
    CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
    AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • BCL2L1
  • Full Name
  • BCL2 like 1
  • Introduction
  • The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator.
  • Alternative Names
  • BCL2L1; BCLX; BCL2L; Bcl-X; PPP1R52; BCL-XL/S; bcl-2-like protein 1; apoptosis regulator Bcl-X; protein phosphatase 1, regulatory subunit 52; BCL2 like 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us