Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BET1L (Bet1 golgi vesicular membrane trafficking protein like) Full Length (CAT#: MPC4582K) Made to Order

This product is a made-to-order Human BET1L membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BET1L
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQN
    RYLDGMDSDFTSMTSLLTGSVKRFSTMARSGQDNRKLLCGMAVGLIVAFF
    ILSYFLSRART

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • BET1L
  • Full Name
  • Bet1 golgi vesicular membrane trafficking protein like
  • Alternative Names
  • BET1L; GS15; BET1L1; GOLIM3; HSPC197; BET1-like protein; GOS-15; blocked early in transport 1 homolog-like; golgi SNARE 15 kDa protein; golgi SNARE with a size of 15 kDa; golgi integral membrane protein 3; vesicle transport protein GOS15; Bet1 golgi vesicular membrane trafficking protein like

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us