Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BSG (Basigin (Ok blood group)) Expressed in Mammalian cell expression system with hIgG1 FC tag at the C-terminus for Antibody Discovery, Partial (138-323aa) (CAT#: MPX4114K)

This product is a 49.3 kDa Human BSG membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BSG
  • Protein Length
  • Partial (138-323aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 49.3 kDa
  • TMD
  • 1
  • Sequence
  • EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • hIgG1 FC tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • BSG
  • Full Name
  • Basigin (Ok blood group)
  • Introduction
  • The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • OK; 5F7; TCSF; CD147; EMPRIN; HAb18G; EMMPRIN; SLC7A11; basigin; OK blood group antigen; collagenase stimulatory factor; extracellular matrix metalloproteinase inducer; hepatoma-associated antigen; leukocyte activation antigen M6; tumor cell-derived collagenase stimulatory factor; BSG; Basigin (Ok blood group)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us