Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BTN2A2 (Butyrophilin subfamily 2 member A2) Expressed in HEK293 for Antibody Discovery, Partial (33-237aa) (CAT#: MPX0830K)

This product is a 50 kDa Human BTN2A2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BTN2A2
  • Protein Length
  • Partial (33-237aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 50 kDa
  • TMD
  • 1
  • Sequence
  • QFTVVGPANPILAMVGEN
    TTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRI
    TFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLG
    SKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIAD
    ADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • BTN2A2
  • Full Name
  • Butyrophilin subfamily 2 member A2
  • Introduction
  • Butyrophilin is the major protein associated with fat droplets in the milk. This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is a type I receptor glycoprotein involved in lipid, fatty-acid and sterol metabolism. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • BTN2A2; BTF2; BT2.2; BTN2.2; butyrophilin 2; Butyrophilin subfamily 2 member A2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us