Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD226 (CD226 molecule) Expressed in NS0 for Antibody Discovery, Partial (19-247aa) (CAT#: MPX0621K)

This product is a 53 kDa Human CD226 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD226
  • Protein Length
  • Partial (19-247aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 53 kDa
  • TMD
  • 1
  • Sequence
  • EEVLWHTSVPFAENMSLECVYPSMGILTQVEW
    FKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASE
    DDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTL
    TCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCS
    HGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD226
  • Full Name
  • CD226 molecule
  • Introduction
  • This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CD226; PTA1; DNAM1; DNAM-1; TLiSA1; CD226 antigen; DNAX accessory molecule-1; T lineage-specific activation antigen 1 antigen; adhesion glycoprotein; platelet and T cell activation antigen 1; CD226 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us