Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD40 (CD40 molecule) Expressed in NS0 for Antibody Discovery, Partial (21-193aa) (CAT#: MPX0158K)

This product is a 47 kDa Human CD40 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD40
  • Protein Length
  • Partial (21-193aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 47 kDa
  • TMD
  • 1
  • Sequence
  • EPPTACREKQYLINSQCCSLCQPGQKLVSD
    CTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETD
    TICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGF
    FSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • CD40
  • Full Name
  • CD40 molecule
  • Introduction
  • This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
  • Alternative Names
  • CD40; p50; Bp50; CDW40; TNFRSF5; tumor necrosis factor receptor superfamily member 5; B cell surface antigen CD40; B cell-associated molecule; CD40 molecule, TNF receptor superfamily member 5; CD40L receptor; CD40 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us