Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CISD2 (CDGSH iron sulfur domain 2) Full Length (CAT#: MPC4271K) Made to Order

This product is a made-to-order Human CISD2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CISD2
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLAL
    LGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCR
    CWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CISD2
  • Full Name
  • CDGSH iron sulfur domain 2
  • Introduction
  • The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2.
  • Alternative Names
  • CISD2; ERIS; WFS2; ZCD2; NAF-1; Miner1; CDGSH iron-sulfur domain-containing protein 2; endoplasmic reticulum intermembrane small protein; mitoNEET-related 1 protein; nutrient-deprivation autophagy factor-1; zinc finger, CDGSH-type domain 2; CDGSH iron sulfur domain 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us