Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLCA3P (Chloride channel accessory 3, pseudogene) Full Length (CAT#: MPC0478K) Made to Order

This product is a 29.9 kDa Human CLCA3P membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLCA3P
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 29.9 kDa
  • Sequence
  • MVFSLKVILFLSLLLSPVLKSSLVTLNNNGYDGIVIAINPSVPEDEKLIQ
    NIKEMVTEASTHLFHATKQRAYFRNVSILIPMTYKSKSEYLIPKQETYDQ
    ADVIVADLYLKYGDDPYTLQYGQCGDKGQYIHFTPNFLLTNNLATYGPRG
    KVFVHGWAHLRWGVFDEYNVDQPFYISRRNTTEATRCSTRITVYMVLNEC
    KGASCIARPFRRDSQTGLYEAKCTFIPKRSQTAKESIVFMQNLDSVTEFC
    TEKTHNKEAPNL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CLCA3P
  • Full Name
  • Chloride channel accessory 3, pseudogene
  • Introduction
  • This gene is a transcribed pseudogene belonging to the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same site on chromosome 1p31-p22 and share high degrees of homology in size, sequence and predicted structure, but differ significantly in their tissue distributions. This gene contains several nonsense codons compared to other family members that render the transcript a candidate for nonsense-mediated mRNA decay (NMD). Therefore, this gene is unlikely to be protein-coding.
  • Alternative Names
  • CLCA3; chloride channel regulator 3 pseudogene; chloride channel, calcium activated, family member 3; CLCA3P; Chloride channel accessory 3, pseudogene

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us