Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC1A (C-type lectin domain family 1 member A) Expressed in NS0 for Antibody Discovery, Partial (77-280aa) (CAT#: MPX0342K)

This product is a 24.8 kDa Human CLEC1A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC1A
  • Protein Length
  • Partial (77-280aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 24.8 kDa
  • TMD
  • 1
  • Sequence
  • QLSNTGQDTISQMEERLGNTSQEL
    QSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQ
    FYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGL
    LRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCK
    ELKRCVCERRAGMVKPESLHVPPETLGEGD

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC1A
  • Full Name
  • C-type lectin domain family 1 member A
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded protein may play a role in regulating dendritic cell function. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CLEC1A; CLEC1; CLEC-1; C-type lectin-like receptor-1; C-type lectin domain family 1 member A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us