Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC1B (C-type lectin domain family 1 member B) Expressed in NS0 for Antibody Discovery, Partial (58-229aa) (CAT#: MPX0331K)

This product is a 21.8 kDa Human CLEC1B membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC1B
  • Protein Length
  • Partial (58-229aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 21.8 kDa
  • TMD
  • 1
  • Sequence
  • QRNYLQGENENRTGTLQQLAKRFCQYVVKQSELKGTFKGHKCS
    PCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKIDNRNIVEYIK
    ARTHLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHN
    GKMHPTFCENKHYLMCERKAGMTKVDQLP

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC1B
  • Full Name
  • C-type lectin domain family 1 member B
  • Introduction
  • Natural killer (NK) cells express multiple calcium-dependent (C-type) lectin-like receptors, such as CD94 (KLRD1; MIM 602894) and NKG2D (KLRC4; MIM 602893), that interact with major histocompatibility complex class I molecules and either inhibit or activate cytotoxicity and cytokine secretion. CLEC2 is a C-type lectin-like receptor expressed in myeloid cells and NK cells.
  • Alternative Names
  • CLEC1B; CLEC2; CLEC2B; PRO1384; QDED721; 1810061I13Rik; C-type lectin-like receptor 2; C-type lectin domain family 1 member B

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us