Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC2A (C-type lectin domain family 2 member A) Expressed in HEK293 for Antibody Discovery, Partial (49-174aa, G136D) (CAT#: MPX0677K)

This product is a 16 kDa Human CLEC2A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC2A
  • Protein Length
  • Partial (49-174aa, G136D)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 16 kDa
  • TMD
  • 1
  • Sequence
  • WS
    KHAKPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQE
    DMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNDWFEIIGNGSFAFLS
    ADGVHSSRGFIDIKWICSKPKYFL

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • HA tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE with silver staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC2A
  • Full Name
  • C-type lectin domain family 2 member A
  • Introduction
  • CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors.
  • Alternative Names
  • CLEC2A; KACL; PILAR; UNQ5792; INPE5792; keratinocyte-associated C-type lectin; proliferation-induced lymphocyte-associated receptor; C-type lectin domain family 2 member A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us