Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CLEC5A (C-type lectin domain containing 5A) Expressed in NS0 for Antibody Discovery, Partial (26-188aa) (CAT#: MPX0498K)

This product is a 20 kDa Human CLEC5A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC5A
  • Protein Length
  • Partial (26-188aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 20 kDa
  • TMD
  • 1
  • Sequence
  • YFPQIFNKSNDGFTTTRSYGTVSQI
    FGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCK
    GKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNG
    NVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 9xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE with silver staining
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC5A
  • Full Name
  • C-type lectin domain containing 5A
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined.
  • Alternative Names
  • CLEC5A; MDL1; MDL-1; CLECSF5; C-type lectin domain family 5 member A; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; C-type lectin superfamily member 5; myeloid DAP12-associating lectin-1; C-type lectin domain containing 5A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us