Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CNEP1R1 (CTD nuclear envelope phosphatase 1 regulatory subunit 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1107K)

This product is a Human CNEP1R1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CNEP1R1
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CNEP1R1
  • Full Name
  • CTD nuclear envelope phosphatase 1 regulatory subunit 1
  • Introduction
  • This gene encodes a transmembrane protein that belongs to the Tmemb_18A family. A similar protein in yeast is a component of an endoplasmic reticulum-associated protein phosphatase complex and is thought to play a role in the synthesis of triacylglycerol. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • CNEP1R1; NEP1R1; TMP125; NEP1-R1; TMEM188; C16orf69; nuclear envelope phosphatase-regulatory subunit 1; nuclear envelope phosphatase 1-regulatory subunit 1; transmembrane protein 188; CTD nuclear envelope phosphatase 1 regulatory subunit 1

Case Studies

Customer reviews and Q&As    

Related Products
  • CAT
  • Product Name
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us