Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human COX15 (Cytochrome c oxidase assembly homolog COX15) Full Length (CAT#: MPC1780K) Made to Order

This product is a 46 kDa Human COX15 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX15
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 46 kDa
  • TMD
  • 8
  • Sequence
  • MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVA
    LQSGRGTVSLPSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMV
    DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
    SHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWY
    MVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHK
    LPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESW
    IPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLP
    RRTKMAAVTLLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALW
    LMNELRRVPK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX15
  • Full Name
  • Cytochrome c oxidase assembly homolog COX15
  • Introduction
  • Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region.
  • Alternative Names
  • COX15; MC4DN6; CEMCOX2; cytochrome c oxidase assembly protein COX15 homolog; COX15 homolog, cytochrome c oxidase assembly protein; COX15, cytochrome c oxidase assembly homolog; cytochrome c oxidase assembly homolog 15; cytochrome c oxidase subunit 15; Cytochrome c oxidase assembly homolog COX15

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us