Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CPD (Carboxypeptidase D) Expressed in Mammalian cell expression system with hIgG1 FC tag at the C-terminus for Antibody Discovery, Partial (383-461aa) (CAT#: MPX4191K)

This product is a 37.3 kDa Human CPD membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CPD
  • Protein Length
  • Partial (383-461aa)
  • Protein Class
  • Protease
  • Molecular Weight
  • 37.3 kDa
  • TMD
  • 1
  • Sequence
  • GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • hIgG1 FC tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CPD
  • Full Name
  • Carboxypeptidase D
  • Introduction
  • The metallocarboxypeptidase family of enzymes is divided into 2 subfamilies based on sequence similarities. The pancreatic carboxypeptidase-like and the regulatory B-type carboxypeptidase subfamilies. Carboxypeptidase D has been identified as a regulatory B-type carboxypeptidase. CPD is a homolog of duck gp180, a hepatitis B virus-binding protein. Transcript variants utilizing alternative polyadenylation signals exist for this gene.
  • Alternative Names
  • CPD; GP180; metallocarboxypeptidase D; Carboxypeptidase D

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us