Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CRB3 (Crumbs cell polarity complex component 3) Full Length (CAT#: MPC3492K) Made to Order

This product is a made-to-order Human CRB3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CRB3
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDG
    NLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQ
    VGARVPPTPNLKLPPEERLI

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CRB3
  • Full Name
  • Crumbs cell polarity complex component 3
  • Introduction
  • This gene encodes a member of the Crumbs family of proteins. This gene is widely expressed in epithelial tissues where the encoded protein isoforms play various roles such as the control of cytokinesis and ciliogenesis or the formation of tight junctions. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • CRB3; protein crumbs homolog 3; crumbs 3, cell polarity complex component; crumbs family member 3; Crumbs cell polarity complex component 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us