Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CTAGE1 (Cutaneous T cell lymphoma-associated antigen 1) Full Length (CAT#: MPC4739K) Made to Order

This product is a made-to-order Human CTAGE1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CTAGE1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSV
    GVLIVLVLCSAFLLLWQGEGVNLR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CTAGE1
  • Full Name
  • Cutaneous T cell lymphoma-associated antigen 1
  • Alternative Names
  • CTAGE1; CTAGE; CT21.1; CT21.2; CTAGE-1; CTAGE-2; cTAGE family member 2; cancer/testis antigen 21.2; cancer/testis antigen family 21, member 1; cancer/testis antigen family 21, member 2; cutaneous T-cell lymphoma-associated antigen 2; protein cTAGE-2; Cutaneous T cell lymphoma-associated antigen 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us