Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CYB5A (Cytochrome b5 type A) Full Length (CAT#: MPC2544K) Made to Order

This product is a made-to-order Human CYB5A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CYB5A
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEV
    LREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI
    TTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CYB5A
  • Full Name
  • Cytochrome b5 type A
  • Introduction
  • The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CYB5A; CYB5; MCB5; METAG; cytochrome b5; cytochrome b5 type A (microsomal); epididymis secretory sperm binding protein; type 1 cyt-b5; Cytochrome b5 type A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us