Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CYP1A2 (Cytochrome P450 family 1 subfamily A member 2) for Antibody Discovery (CAT#: MP1090J)

This product is a 58.2 kDa Human CYP1A2 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CYP1A2
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, P450, Transmembrane
  • Molecular Weight
  • 58.2 kDa
  • Sequence
  • MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKNPHLALSRMSQ
    RYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDGQSLTFSTDSGPVWAARRRLA
    QNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELMAGPGHFDPYNQVVVSVANVIGAMCFGQHFP
    ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSV
    RDITGALFKHSKKGPRASGNLIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTV
    IGRERRPRLSDRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
    WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPPGVKVD
    LTPIYGLTMKHARCEHVQARLRFSIN

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • CYP1A2
  • Full Name
  • Cytochrome P450 family 1 subfamily A member 2
  • Introduction
  • This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region.
  • Alternative Names
  • CP12; CYPIA2; P3-450; P450(PA)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us