Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CYSTM1 (Cysteine rich transmembrane module containing 1) for Antibody Discovery (CAT#: MP0976X)

This product is a 36.41 kDa Human CYSTM1 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CYSTM1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 36.41 kDa
  • TMD
  • 1
  • Sequence
  • MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • CYSTM1
  • Full Name
  • Cysteine rich transmembrane module containing 1
  • Introduction
  • 182 organisms have orthologs with human gene CYSTM1.
  • Alternative Names
  • C5orf32; ORF1-FL49; cysteine-rich and transmembrane domain-containing protein 1; UPF0467 protein C5orf32; putative nuclear protein ORF1-FL49

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us