Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DEGS2 (Delta 4-desaturase, sphingolipid 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1643K)

This product is a Human DEGS2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DEGS2
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Oxidoreductase
  • TMD
  • 3
  • Sequence
  • GNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLACWLVRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPYAASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPKAVTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGHETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLAKDGL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • DEGS2
  • Full Name
  • Delta 4-desaturase, sphingolipid 2
  • Introduction
  • This gene encodes a bifunctional enzyme that is involved in the biosynthesis of phytosphingolipids in human skin and in other phytosphingolipid-containing tissues. This enzyme can act as a sphingolipid delta(4)-desaturase, and also as a sphingolipid C4-hydroxylase.
  • Alternative Names
  • DEGS2; DES2; FADS8; C14orf66; sphingolipid delta(4)-desaturase/C4-monooxygenase DES2; degenerative spermatocyte homolog 2, lipid desaturase; dihydroceramide desaturase 2; sphingolipid 4-desaturase; sphingolipid C4-hydroxylase/delta 4-desaturase; sphingolipid C4-monooxygenase; sphingolipid delta 4 desaturase/C-4 hydroxylase; sphingolipid delta(4)-desaturase 2; sphingolipid delta(4)-desaturase/C4-hydroxylase DES2; Delta 4-desaturase, sphingolipid 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us