Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DLK2 (Delta like non-canonical Notch ligand 2) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (27-306aa) (CAT#: MPX4414K)

This product is a 31.8kDa Human DLK2 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DLK2
  • Protein Length
  • Partial (27-306aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 31.8kDa
  • TMD
  • 1
  • Sequence
  • DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • DLK2
  • Full Name
  • Delta like non-canonical Notch ligand 2
  • Alternative Names
  • DLK2; DLK-2; EGFL9; protein delta homolog 2; EGF-like protein 9; EGF-like-domain, multiple 9; delta-like 2 homolog; epidermal growth factor-like protein 9; Delta like non-canonical Notch ligand 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us