Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DLL3 (Delta like canonical Notch ligand 3) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (27-492aa) (CAT#: MPX4231K)

This product is a 50.5kDa Human DLL3 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DLL3
  • Protein Length
  • Partial (27-492aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 50.5kDa
  • TMD
  • 1
  • Sequence
  • AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • DLL3
  • Full Name
  • Delta like canonical Notch ligand 3
  • Introduction
  • This gene encodes a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1. Two transcript variants encoding distinct isoforms have been identified for this gene.
  • Alternative Names
  • DLL3; SCDO1; delta-like protein 3; delta-like 3; delta3; drosophila Delta homolog 3; Delta like canonical Notch ligand 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us